MockCheckride logoMockCheckride

Free Oral Exam Study Guides

Master the toughest DPE questions with plain-English explanations written for the checkride, not the textbook.

Topics Covered

Regulations (FAR Part 61 & 91)

Weather (METARs, TAFs, SIGMETs)

Navigation (Charts & Airspace)

Aircraft Systems & Airworthiness

Aerodynamics & Performance

Airport Ops & NOTAMs

Emergency Procedures

Weight & Balance

Latest Study Guides

checkrideprivate pilotoral examemergency-proceduresMarch 22, 2026

What Is the First Action a Pilot Should Take When Faced With Any Emergency in Flight?

When an emergency strikes in the cockpit, most student pilots instinctively want to grab the checklist or call ATC — but that instinct can be deadly. The FAA's Airplane Flying Handbook makes the priority order crystal clear: aviate, navigate, communicate. Here's what that means and why it matters on your checkride.

Read full guide →
checkrideprivate pilotoral examairport-operationslost-commlight-gun-signalsMarch 21, 2026

What Are All Six Light Gun Signal Meanings for Aircraft in the Air, and How Do You Acknowledge Them?

Light gun signals are a critical but frequently underestimated topic on the private pilot oral exam. Knowing all six in-flight meanings, how to acknowledge them, and what to do after landing with lost comms can be the difference between a pass and a pink slip. Here is everything you need to know.

Read full guide →
checkrideprivate pilotoral examaerodynamicsgo-aroundflapsperformanceMarch 20, 2026

During a Go-Around from a Full-Flap Approach, Why Must You Retract Flaps Incrementally Rather Than All at Once, and What Is the Correct Procedure?

Retracting flaps all at once during a go-around is one of the most dangerous mistakes a pilot can make at low altitude. Learn why incremental flap retraction is critical, what the correct procedure looks like, and how to answer this hard-rated checkride question with confidence.

Read full guide →
checkrideprivate pilotoral examnavigationVFR chartssectional chartsMarch 18, 2026

What Are the Three Main Types of VFR Aeronautical Charts and Their Scales?

Every private pilot checkride candidate needs to know the three main VFR aeronautical charts and their scales cold. Mixing up the Sectional, Terminal Area Chart, and World Aeronautical Chart is one of the most common oral exam stumbles. Here is exactly what you need to know.

Read full guide →
checkrideprivate pilotoral examregulationsFAR Part 91careless or reckless operationMarch 17, 2026

What Does 14 CFR 91.13 Prohibit, and How Broadly Can It Be Applied?

14 CFR 91.13 is one of the FAA's most powerful enforcement tools, and it often surprises student pilots just how broadly it can reach. Understanding this catch-all regulation is essential for your private pilot oral exam. Learn what it covers, how the FAA applies it, and the common misconceptions that trip up checkride candidates.

Read full guide →
checkrideprivate pilotoral examweather-meteorologywind-shearmicroburstMarch 16, 2026

What Is a Microburst, and What Makes It So Dangerous to Aircraft?

A microburst is one of the most lethal weather phenomena a pilot can encounter, capable of overwhelming an aircraft's performance in seconds. Understanding its structure, wind shear sequence, and hidden forms like dry microbursts is essential checkride knowledge. Here is what every private pilot candidate needs to know before their oral exam.

Read full guide →
checkrideprivate pilotoral examaircraft-systemsairworthinessFAR-91March 15, 2026

What Is the ELT, When Is It Required, and When Must the Battery Be Replaced?

The ELT is a favorite checkride topic because it combines systems knowledge with regulatory detail. Learn what the ELT does, when it is required, and the exact battery replacement rules your DPE expects you to know cold.

Read full guide →
checkrideprivate pilotoral examweight-and-balanceMarch 14, 2026

How to Walk Through a Complete Weight and Balance Calculation on Your Private Pilot Checkride

Weight and balance is one of the most practical and frequently tested topics on the private pilot oral exam. Learn the exact process examiners expect, the numbers you must know cold, and the common mistakes that trip up unprepared candidates.

Read full guide →
checkrideprivate pilotoral examemergency-proceduresMarch 13, 2026

When and How Do You Perform an Emergency Descent, and What Speed Limitations Apply?

Emergency descent procedures are a critical topic on the private pilot oral exam. Learn when to initiate a rapid descent, how to execute it correctly, and which speed limitations protect your aircraft from structural damage.

Read full guide →
checkrideprivate pilotoral examairport-operationsMarch 12, 2026

What Is a Displaced Threshold and How Does It Affect Landing and Takeoff Operations?

A displaced threshold is one of the most misunderstood runway markings a student pilot will encounter on their checkride. Understanding what you can and cannot do in that pavement area before the threshold bar is critical for both safety and passing your oral exam. Here is what every private pilot candidate needs to know.

Read full guide →
checkrideprivate pilotoral examairport-operationslight-gun-signalsairspaceMarch 12, 2026

What Does a Steady Red Light Gun Signal Mean for an Aircraft in the Air vs. on the Ground?

Light gun signals are a critical backup communication method every private pilot must know cold before their checkride. Understanding the difference between steady red in the air versus on the ground — and how it differs from flashing red — can make or break your oral exam. Here is what the AIM says and what your examiner expects you to know.

Read full guide →
checkrideprivate pilotoral examaerodynamicsstabilitylateral-stabilityMarch 11, 2026

How Does Dihedral Angle Contribute to Lateral Stability in an Aircraft?

Dihedral angle is one of the most elegant design features in aviation — a simple upward wing angle that keeps your airplane flying wings-level without constant input. Understanding the mechanism behind it is essential for your private pilot checkride oral exam. Here's exactly what your DPE wants to hear.

Read full guide →
checkrideprivate pilotoral examemergency-proceduresspin-recoveryaerodynamicsMarch 11, 2026

Explain the Aerodynamic Conditions That Cause a Spin, How You Recognize a Developed Spin, and the Correct Recovery Procedure

Spins are one of the most misunderstood emergency scenarios on the private pilot checkride. Learn the aerodynamics behind spin entry, how to identify a developed spin, and the exact PARE recovery procedure your DPE expects you to know cold.

Read full guide →
checkrideprivate pilotoral examaircraft-systemselectrical-systememergency-proceduresMarch 10, 2026

Alternator Failure in Flight: What You Need to Know for Your Private Pilot Oral Exam

An alternator failure in flight is one of those emergencies that demands immediate recognition and decisive action. Learn how to identify the indications, manage your electrical system, and make smart decisions before your checkride oral exam.

Read full guide →
checkrideprivate pilotoral examaerodynamicsaircraft-performanceMarch 9, 2026

How Does Increased Gross Weight Affect Aircraft Performance?

Gross weight touches nearly every performance parameter your aircraft has, from stall speed to landing roll. Understanding exactly how and why weight degrades performance is essential knowledge for your private pilot checkride oral exam. Here is what you need to know before you sit down with a DPE.

Read full guide →
checkrideprivate pilotoral examaerodynamicsload-factorstall-speedsteep-turnsMarch 8, 2026

How Does Bank Angle Affect Load Factor and Stall Speed? What Is the Load Factor at a 60-Degree Bank?

Steep turns do more than change your heading — they dramatically increase load factor and raise your stall speed in ways that can catch unprepared pilots off guard. Understanding the math behind bank angle, load factor, and stall speed is essential for your private pilot checkride. Here is what every student pilot needs to know before sitting across from a DPE.

Read full guide →
checkrideprivate pilotoral examairworthinessinoperative-equipment91.213March 7, 2026

Inoperative Nav Light, No MEL: Can You Legally Fly Day VFR and What Process Do You Follow?

A broken nav light does not automatically ground your aircraft for a day VFR flight. Understanding the 91.213 process is essential for your checkride — and for your flying career. Here is exactly how to work through it.

Read full guide →
checkrideprivate pilotoral examaircraft-systemspreflightairworthinessMarch 6, 2026

What Oil Grade Is Typically Used in an Aircraft Engine, and When Should You Check the Oil Level?

Knowing the right oil grade for your aircraft engine and when to check it are fundamental checkride topics that every private pilot candidate must nail. This post breaks down aviation oil grades, where to find the specs, and the correct preflight procedure your DPE expects to hear. Get it right before your oral exam.

Read full guide →
checkrideprivate pilotoral examregulationsFAR Part 61flight reviewMarch 5, 2026

What Are the Minimum Requirements for a Flight Review Under 14 CFR 61.56?

Every certificated pilot needs a flight review to stay current as PIC, but many pilots get the details wrong. Here is exactly what 14 CFR 61.56 requires so you walk into your checkride with confidence.

Read full guide →
checkrideprivate pilotoral examemergency-procedurescarbon-monoxideaeromedicalMarch 4, 2026

Passenger Has a Headache and You Feel Tired Mid-Flight: What Should a Private Pilot Suspect?

Headache and drowsiness in the cockpit are classic signs of carbon monoxide poisoning — a silent killer that strikes without warning. Knowing how to recognize and respond to CO poisoning could save your life and your passenger's. Here is exactly what your examiner expects you to know on checkride day.

Read full guide →
checkrideprivate pilotoral examairspacesectional chartsClass E airspaceMarch 3, 2026

What Is Class E Airspace and Where Does It Begin? Why Does It Extend to the Surface Around Some Airports?

Class E airspace covers the vast majority of the U.S. national airspace system, but its floor shifts depending on where you are — and that detail trips up a lot of checkride candidates. Understanding the difference between the 1,200-foot, 700-foot, and surface floors is essential for reading sectional charts and answering your DPE confidently. Here is what you need to know before your oral exam.

Read full guide →
checkrideprivate pilotoral examweather-and-meteorologyaltimetryperformanceMarch 2, 2026

How Does Pressure Altitude Differ From Indicated Altitude, and When Does a Pilot Need to Use It?

Understanding the difference between pressure altitude and indicated altitude is a core checkride topic that trips up more student pilots than you might expect. Know when to use 29.92 inHg, how to apply it to performance charts, and what happens in Class A airspace. Get it right before your oral exam.

Read full guide →
checkrideprivate pilotoral examalcohol-regulationsFAR-91.17March 1, 2026

Can a Pilot Legally Fly 10 Hours After Having Several Drinks If They Feel Fine?

The 8-hour bottle-to-throttle rule is one of the most misunderstood regulations in Part 91. Feeling fine after several drinks does not make you legal to fly — and your DPE will expect you to know exactly why. Here is what 14 CFR 91.17 actually requires.

Read full guide →
checkrideprivate pilotoral examaerodynamicsstallsangle-of-attackFebruary 28, 2026

At What Speed Does a Stall Occur, and Can an Aircraft Stall at High Airspeed?

Most student pilots think stalls are about airspeed — they are not. A stall occurs when the critical angle of attack is exceeded, and that can happen at any speed, any attitude, and any power setting. Understanding this distinction is essential for your checkride and your safety as a pilot.

Read full guide →
checkrideprivate pilotoral examweather-meteorologyTAFweather-servicesFebruary 27, 2026

What Does 'PROB30' in a TAF Mean, and How Should a Pilot Use This Information in Planning?

PROB30 in a TAF indicates a 30% probability of specific weather conditions occurring during a forecast period — and dismissing it as unlikely could put your flight at risk. Learn what PROB30 really means, how it differs from other change groups, and how to use it smartly during preflight planning.

Read full guide →
checkrideprivate pilotoral examemergency-procedures14-cfr-91-3pic-authorityFebruary 26, 2026

Under 14 CFR 91.3, What Authority Does the PIC Have in an Emergency, and What Is Required Afterward?

14 CFR 91.3 gives the pilot in command sweeping authority to deviate from any FAR during an emergency — but most student pilots don't fully understand what that means or what comes next. Here's everything you need to know before your checkride oral exam.

Read full guide →
checkrideprivate pilotoral examweather-meteorologystandard-atmospherealtimetryFebruary 25, 2026

What Are the Standard Sea-Level Values for Pressure and Temperature in the International Standard Atmosphere?

Every private pilot checkride candidate needs to know the standard sea-level values for pressure and temperature in the ISA — and why they matter. Learn the numbers, understand the lapse rate, and avoid the common mistakes that trip up students on oral exam day.

Read full guide →
checkrideprivate pilotoral examairport-operationsVASIPAPIvisual-approachFebruary 24, 2026

How Do You Interpret a VASI and a PAPI, and What Do the Light Colors Indicate?

Understanding VASI and PAPI lighting systems is a fundamental checkride topic every private pilot candidate must master. Learn how to read the light colors, avoid the most common interpretation mistakes, and explain these systems confidently to your DPE.

Read full guide →
checkrideprivate pilotoral examaircraft-systemsignition-systemmagnetosFebruary 23, 2026

How Does a Magneto Ignition System Work, and Why Does an Aircraft Engine Have Two Magnetos?

Understanding how magnetos work — and why your aircraft has two of them — is a core checkride topic that every private pilot candidate must nail. This post breaks down the system, the redundancy logic, and the critical mag check details your examiner will probe. Get this one right and you'll walk into your oral with confidence.

Read full guide →
checkrideprivate pilotoral examnavigationdead reckoningfuel planningFebruary 22, 2026

Your Groundspeed Is Lower Than Planned: How It Affects Your ETA and Fuel on the Private Pilot Oral Exam

Discovering your groundspeed is 20 knots slower than planned mid-flight is a classic checkride scenario that tests your real-world pilot judgment. Learn how to recalculate your ETA, reassess your fuel, and make the right decision — divert or continue. This is exactly the kind of question your DPE will ask.

Read full guide →
checkrideprivate pilotoral examaircraft-systemsengine-coolingairworthinessFebruary 21, 2026

How Does an Air-Cooled Aircraft Engine Stay Within Safe Operating Temperatures?

Most light aircraft piston engines rely on airflow — not liquid coolant — to manage heat. Understanding how air cooling works, what can go wrong, and how to monitor cylinder head temperature is essential knowledge for your private pilot checkride oral exam.

Read full guide →
checkrideprivate pilotoral examairport-operationsFebruary 20, 2026

What Is ATIS and What Information Does It Contain?

ATIS is one of the first things you interact with on any flight into a controlled airport, and your DPE will expect you to know exactly what it is and how to use it. Learn what ATIS contains, when it updates, and how to use it correctly on initial radio contact. Nail this question on your private pilot checkride oral exam.

Read full guide →
checkrideprivate pilotoral exampreflightAROWrequired documentsFebruary 19, 2026

What Required Documents Must Be On Board the Aircraft, and What Must the Pilot Carry?

Knowing which documents belong in the aircraft and which ones stay with the pilot is a foundational checkride question every private pilot candidate must nail. Learn the AROW acronym, the pilot document requirements, and the common mistakes that trip up students on exam day.

Read full guide →
checkrideprivate pilotoral examairworthinessFAR Part 91PIC responsibilityFebruary 18, 2026

Who Is Responsible for Determining That an Aircraft Is Airworthy Before Flight?

One of the most fundamental questions on your private pilot oral exam is also one of the most commonly misunderstood: who is actually responsible for airworthiness on the day of flight? The answer lives in 14 CFR 91.7, and your examiner will expect you to own it confidently. Here is what you need to know.

Read full guide →
checkrideprivate pilotoral examaircraft-systemsengine-managementfuel-systemsFebruary 17, 2026

What Is the Purpose of the Mixture Control and How Does Altitude Affect Mixture Setting?

Understanding the mixture control is essential for efficient engine management and a confident checkride performance. Learn why air density at altitude forces you to lean, what happens when you don't, and the rules your examiner expects you to know cold.

Read full guide →
checkrideprivate pilotoral examweight-and-balanceFebruary 16, 2026

What Are the Dangers of an Aft CG, and Why Is It the Most Dangerous Loading Condition?

An aft center of gravity is considered the most dangerous loading condition a pilot can encounter — not because it makes the aircraft more agile, but because it can make a stall or spin unrecoverable. Understanding why the aft CG limit exists is essential knowledge for your private pilot checkride. Here is what every student pilot needs to know before sitting down with a DPE.

Read full guide →
checkrideprivate pilotoral examnavigationsectional-chartsMEFFebruary 15, 2026

What Is the Maximum Elevation Figure (MEF) on a Sectional Chart and How Is It Calculated?

The Maximum Elevation Figure (MEF) is one of those sectional chart details that DPEs love to probe during the oral exam. Understanding how it is calculated — and what it does not guarantee — can make the difference between a confident answer and a stumble. Here is everything a private pilot candidate needs to know.

Read full guide →
checkrideprivate pilotoral examflight-instrumentsairspeed-indicatoraircraft-systemsFebruary 14, 2026

What Are the Color-Coded Arcs on the Airspeed Indicator and What Do They Represent?

Every color on your airspeed indicator tells a story about your aircraft's structural and aerodynamic limits. Understanding what each arc and line represents is essential knowledge for your private pilot checkride oral exam.

Read full guide →
checkrideprivate pilotoral examairspaceregulationsFAR-91February 13, 2026

What Speed Limit Applies When Flying Underneath the Class B Airspace Shelf?

Most student pilots know the 250-knot rule below 10,000 feet, but a stricter limit kicks in when you fly beneath a Class B airspace shelf. Understanding 14 CFR 91.117(c) is essential for your checkride and for staying legal in busy airspace.

Read full guide →
checkrideprivate pilotoral examemergency-proceduresFebruary 12, 2026

What Criteria Do You Use to Select an Emergency Landing Field, and Where Do You Aim on the Field?

Knowing how to pick a safe emergency landing field — and where to touch down on it — is a core checkride skill that could save your life. This post breaks down exactly what your DPE wants to hear and the mistakes that catch student pilots off guard.

Read full guide →
checkrideprivate pilotoral examgps-navigationFebruary 11, 2026

What Is RAIM and Why Is It Important for GPS Navigation?

RAIM — Receiver Autonomous Integrity Monitoring — is the built-in self-check your GPS uses to verify the accuracy of its own position data. Understanding how it works, when it can fail, and what to do about it is essential knowledge for your private pilot checkride. Here is what every student pilot needs to know.

Read full guide →
checkrideprivate pilotoral examaerodynamics-and-performanceFebruary 10, 2026

What Is Density Altitude and How Does It Affect Aircraft Performance?

Density altitude is one of the most important performance concepts a private pilot candidate must understand before their checkride. Learn what it is, how to calculate it, and exactly how it degrades your aircraft's performance on hot, high, or humid days.

Read full guide →
checkrideprivate pilotoral examairport-operationstaxiingATCFebruary 9, 2026

What Is Progressive Taxi and When Would a Pilot Request It?

Progressive taxi is a valuable ATC service that guides pilots step by step across complex or unfamiliar airports. Knowing when and how to request it could save you from a runway incursion — and it is almost certain to come up on your checkride oral exam.

Read full guide →
checkrideprivate pilotoral examregulationsFAR Part 61logbookFebruary 8, 2026

What Flight Time Must Be Logged Under 14 CFR 61.51?

Your logbook is more than a personal record — it's a legal document that must meet specific FAA requirements. Learn exactly what flight time must be logged under 14 CFR 61.51 and how to avoid the mistakes that trip up checkride candidates.

Read full guide →
checkrideprivate pilotoral examaerodynamicsFebruary 7, 2026

What Causes Adverse Yaw, and How Do You Correct for It?

Adverse yaw is one of the most commonly misunderstood aerodynamic concepts on the private pilot oral exam. Learn exactly what causes it, why it matters for flight safety, and how coordinated rudder use keeps you in control. Understanding this topic cold could make the difference on checkride day.

Read full guide →
checkrideprivate pilotoral examaircraft-systemsfuel-systemsairworthinessFebruary 6, 2026

What Type of Fuel Does a Typical Training Aircraft Use, and How Do You Identify It on the Ground?

Most piston training aircraft run on 100LL avgas, but do you know why it's blue, what 'LL' actually means, and how to spot dangerous Jet A contamination during preflight? These details matter on your checkride and in real flying.

Read full guide →
checkrideprivate pilotoral examaerodynamicsFebruary 5, 2026

What Are the Four Forces Acting on an Aircraft in Flight, and What Is Their Relationship in Straight-and-Level Unaccelerated Flight?

Lift, weight, thrust, and drag are the four forces every private pilot must understand cold before their checkride. Learn how these forces interact in straight-and-level unaccelerated flight and why getting the details right matters to your DPE.

Read full guide →
checkrideprivate pilotoral examaircraft-performancetakeoff-performancedensity-altitudeFebruary 4, 2026

What Factors Increase Takeoff Roll Distance, and How Should a Pilot Account for Them?

Takeoff performance is one of the most safety-critical calculations a pilot makes, and your examiner will expect you to know exactly what stretches your ground roll. Learn the key factors that increase takeoff distance and how to use your POH to account for every one of them before checkride day.

Read full guide →
checkrideprivate pilotoral examperformance-chartsdensity-altitudeweight-and-balanceFebruary 3, 2026

Mountain Airport Takeoff on a Hot Day: How to Use Performance Charts on Your Checkride

A mountain airport on a hot summer afternoon is one of the most demanding scenarios a private pilot can face — and your examiner knows it. Learn exactly how to use your POH takeoff performance charts, what inputs they require, and what mistakes will cost you on checkride day.

Read full guide →
checkrideprivate pilotoral examairport-operationstraffic-patternairspaceFebruary 2, 2026

What Is the Standard Traffic Pattern and What Are Its Five Legs?

The standard traffic pattern is one of the most fundamental concepts in airport operations, and your examiner will almost certainly ask about it. Learn the five legs, why left turns are standard, and the mistakes that trip up checkride candidates every day.

Read full guide →
checkrideprivate pilotoral exampreflight-inspectionfuel-systemsairworthinessFebruary 1, 2026

Water in Your Fuel Sump: What That Clear Liquid Means on Your Checkride

Draining a fuel sump and finding a clear liquid beneath your blue avgas is one of the most important preflight discoveries a pilot can make. Learn exactly what it means, why it happens, and how to handle it correctly before your checkride examiner asks.

Read full guide →
checkrideprivate pilotoral examairport-operationslost-commlight-gun-signalsJanuary 31, 2026

What Are All Six Light Gun Signal Meanings for Aircraft in the Air, and How Do You Acknowledge Them?

Light gun signals are a required knowledge item for your private pilot checkride, and DPEs love asking about all six. Learn every signal, what each one means in the air, how to acknowledge them, and what to do after you land without a radio.

Read full guide →
checkrideprivate pilotoral examaircraft-systemsignition-systemairworthinessJanuary 30, 2026

What Is the Purpose of the P-Lead, and What Happens If It Is Broken?

The p-lead is a small wire with enormous safety implications. Understanding what it does — and what happens when it fails — is essential knowledge for your private pilot checkride and for every preflight you will ever conduct.

Read full guide →
checkrideprivate pilotoral examaircraft-systemsignition-systemairworthinessJanuary 29, 2026

During a Magneto Check Before Takeoff, You Notice a 350 RPM Drop on the Left Magneto: What Does This Indicate and What Should You Do?

A 350 RPM drop on one magneto during your runup is a serious red flag that no safe pilot should ignore. Understanding what causes excessive mag drops — and knowing the acceptable limits — is essential knowledge for your private pilot checkride. Here is what your DPE expects you to know.

Read full guide →
checkrideprivate pilotoral examweather-and-meteorologyJanuary 28, 2026

How Pressure Gradient Force, Coriolis Effect, and Friction Interact to Produce Surface Wind — Private Pilot Oral Exam

Understanding why surface winds behave differently from winds aloft is one of the harder meteorology questions on the private pilot oral exam. This post breaks down how pressure gradient force, Coriolis effect, and friction interact to shape the winds you actually fly in. Master this three-force relationship and you will answer your examiner with confidence.

Read full guide →
checkrideprivate pilotoral examnavigationcross-countryVFRJanuary 27, 2026

How Do You Select Visual Checkpoints When Planning a VFR Cross-Country Flight?

Selecting the right visual checkpoints is one of the most practical skills your examiner will probe during your checkride oral. Learn how to choose, space, and use checkpoints the way the FAA expects — so you never find yourself lost on a cross-country flight.

Read full guide →
checkrideprivate pilotoral examflight-instrumentspitot-static-systemairworthinessJanuary 26, 2026

What Happens to Your Altimeter and VSI If the Static Port Becomes Blocked?

A blocked static port affects more instruments than most student pilots realize — and the fix introduces its own error. Here is what your DPE expects you to know cold before your checkride.

Read full guide →
checkrideprivate pilotoral examweather-briefingJanuary 25, 2026

What Is the Difference Between a Standard Briefing and an Abbreviated Weather Briefing?

Knowing when to request a standard versus abbreviated weather briefing is a foundational checkride topic. Your examiner expects you to understand not just the definitions, but when and how to use each type. Here is what you need to know before your oral exam.

Read full guide →

Ready to Test Your Knowledge?

Our AI mock oral exam covers every ACS topic — voice-to-voice, just like the real checkride.

Start My Mock Oral Exam — $59.99